PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000166889
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 301aa    MW: 33653.8 Da    PI: 8.2002
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000166889genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.88.2e-20223257135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C++C++tkTp+WR+gp g+ktLCnaCG++yr+ +l
  MDP0000166889 223 CTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRL 257
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.347217253IPR000679Zinc finger, GATA-type
SMARTSM004011.4E-16217267IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15219280No hitNo description
Gene3DG3DSA:3.30.50.102.6E-14221254IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.88E-16222269No hitNo description
PfamPF003201.2E-17223257IPR000679Zinc finger, GATA-type
PROSITE patternPS003440223248IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTAVSADVAK LTKRENISDM DGSLPADGAF NYESILSALD FPMEDIDDSV EDNDWDTKFQ  60
DIEPPPNIDQ LLGPGIFSYD DEKKHTNLST PLMVKQYGHM YQRPQFPSVT CETIRSRVSL  120
RKDGLESIGS CAAQFEPKFE KRTRSKLSRS RRANPIIFST QFILSTSSNS SASENLYRWD  180
ACEFDLEASR TEDTSNTAKR KQKKKTGKLS MDEAGESRET KRCTHCQVTK TPQWREGPLG  240
PKTLCNACGV RYRSGRLLPE YRPAASPTFV ASVHSNSHKK VIELRSKSCQ GASMGILSSA  300
Q
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.7450.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359306.10.0PREDICTED: GATA transcription factor 11-like
TrEMBLM5VZX11e-82M5VZX1_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57582849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-37GATA family protein